PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G01980.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 1870aa    MW: 200949 Da    PI: 7.5693
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G01980.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.11.7e-0710171059347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       +W +eE e++ +  + +G++ +++I++ ++ ++t  +c+++++k+
  ORUFI05G01980.4 1017 PWIQEEKEIFMEKLATFGKD-FSKISSFLQ-HKTTADCIEFYYKH 1059
                       899***************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.28E-1310001062IPR009057Homeodomain-like
PROSITE profilePS5129314.54710131064IPR017884SANT domain
SMARTSM007174.8E-710141062IPR001005SANT/Myb domain
PfamPF002491.1E-510171059IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-510171061IPR009057Homeodomain-like
PROSITE profilePS5129313.72812221273IPR017884SANT domain
SMARTSM007176.6E-412231271IPR001005SANT/Myb domain
SuperFamilySSF466891.79E-812271273IPR009057Homeodomain-like
CDDcd001670.0014512271265No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1870 aa     Download sequence    Send to blast
MASTAAAASR RESSAASRTL VWSWWRGGRG GGVLGLPARP RERSWPLIVG QGRTQGCGSI  60
GVKGLGLRPL YRLTLSQAAA ASVFSPLLSS PPHLSPLSPS FSPAPRPPPP PPPPPPPPPS  120
LHADQGASAS AHAAADASPT WGALGAAACT SDCLPDSTPR ISSAACSTGG GEGKAWTSTS  180
LSDLRRPTSA AAAATDSAGD GSPGIGGGRR RCRVGFFAAR MRRPELGIRA GWTTTTTTTT  240
TPWMPPPPPD RRDFLYRDGR RHDGDPLPPP APTPPRWRDS PYHPPPPPPP LRDHSRPSPR  300
RTPSSASSDG YYRQGGGSYD RSYPDESLGY TPSRSDRYWL DDDGGGGGYK GFSRYGGGGG  360
GGSRRDGRDM RGSYRRSPFR GYGSDFSRNH QEHPPPPLRR SPLRSVAVPM SYDPPGDRAD  420
RGDRDHHHRV TPWRPLRRRE SRSDAADAAG AGPVPVGQAA AAAASEKDVS ARSSAVAAPQ  480
VSEEEAPRKK PRLGWGQGLA KYEKQKVQGP AESAEAVAEG SPTATEQKGI THTPAPAPCV  540
SPVAAPSPTP CASPVAAPSP APCVSPVAAP SPAPPCKSPV PEDKSCELTA NTVTESNKNI  600
PGPDVQACNN EVPTKLDQLE GDPIDSLAKV LSELVQHEDS CSGDSKRLSN VSKLLLLKES  660
ISKELEKTEL EIDSLEGELK SVNVEARNRT LKDPPTAVTY AQNPSPSPVK EQGELTPSPK  720
ISMEQDADVK GSELMEIETA QAHNAKAVSS EESVACPGVA LGQVPAAADV IPSDPCGKTG  780
SGIDVDIEQR EENPCQETFN AMKADGSSDL ATRPCSYREV KYNLMDQIIA ANRSEAKKNS  840
QLLFKPVPAD RSNLDLLASS YLSSQMKNDV IIKKKHAILK NRQRFKEQIL TFKFRVLRHL  900
WKEDVRLLSV RKQRSKSHKR TDQSNRSSQS GSQRQRSSNR SRLAVPAGNL STFPITEMSG  960
VARKLFSEFQ LKRCRNYLKM PALIVDEKEK AGAKFVSKNG LVEDPVSVEK ERALINPWIQ  1020
EEKEIFMEKL ATFGKDFSKI SSFLQHKTTA DCIEFYYKHH KSDSFREVKK LLDLRQQQQP  1080
ASNYLGAVSG KKWNPEANAA SLDMLGVATE VAAQGLEYVN EVKKNSAKSI LRTVCGVDNS  1140
TKGSEKDCVG DVSLHERESV AADVLAGICG TLSPEGMGSC ITSSADPGQK IGIISRMEHL  1200
LTPEADKNFD DDGTLSDQEC EVDIVDWNDD EKSSFIEAMN RYGKDFARIS SYVKSKSFEQ  1260
CKVFFSKARK SLGLDLIHQG AADAGFPTGD ANGGRSGTDG ACIAEMDSAI CSAQSCPKVE  1320
IDACPVSDGE IQGHNPLSDI ASRQPEADKS NMPDVVDINV EEGESKAEKD CSILVDHKQL  1380
REDINQTSCA RIDINCPEST DKLQDIEDVT PVNMHGDDLM ATSVEQVAAA HVESRSSLHS  1440
EGIGIDVSRI EGCSHESTIG KGGKSTPSVC LPAENGVSKE NIIHFSNMDG ASSISPAFTS  1500
NYQQSKLADP IQSKPKPLTP KDLMPVQFSS SLPDPTSICF EGIAAITTPN FEDHGNRASI  1560
ASGAKDVNMF PTFKDQSSNR HDALFSNVDG YMQQRRNNHF GTEVCGLSES TGISQSDQFT  1620
VSKFQNGRPS SLGLSNGNLG VLSTGRREEA REGLFRPCSV KTSAGNEEQQ KRPGDVKLFG  1680
QILSHQSSLQ SSGSSVHGSK SKPPSPKVDK PASSRLLSNP RERLVYSSRP PIIANLGLEE  1740
RAMRSFDHMD GRTIQPEPMV MVAKCQRPSA GVPVYSTKNG TLSVFAEFQQ PSMPPHTSDH  1800
KLLENFADLH KRNGIELLSG FQQPGRLGGA GVLVSGVSDP VAALKAQYGS GSKMLSSSND  1860
VDTWKDIGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-169751066494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-169751066494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0706530.0AK070653.1 Oryza sativa Japonica Group cDNA clone:J023055D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639126.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639127.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639128.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639129.10.0PREDICTED: uncharacterized protein LOC9268524
TrEMBLA0A0E0PGZ20.0A0A0E0PGZ2_ORYRU; Uncharacterized protein
STRINGLOC_Os05g03550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-76MYB family protein